Lineage for d3v3yh2 (3v3y H:36-250)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2052955Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 2052956Superfamily b.41.1: PRC-barrel domain [50346] (5 families) (S)
  5. 2052957Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 protein domains)
  6. 2052958Protein Photosynthetic reaction centre [50348] (4 species)
  7. 2052959Species Rhodobacter sphaeroides [TaxId:1063] [50350] (84 PDB entries)
    Uniprot P11846
  8. 2053040Domain d3v3yh2: 3v3y H:36-250 [201148]
    Other proteins in same PDB: d3v3yh1, d3v3yl_, d3v3ym_
    automated match to d1l9bh1
    complexed with bcl, bph, cl, dio, fe, lda, po4, spn, u10

Details for d3v3yh2

PDB Entry: 3v3y (more details), 2.8 Å

PDB Description: Photosynthetic Reaction Center From Rhodobacter Sphaeroides strain RV
PDB Compounds: (H:) reaction center protein h chain

SCOPe Domain Sequences for d3v3yh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3v3yh2 b.41.1.1 (H:36-250) Photosynthetic reaction centre {Rhodobacter sphaeroides [TaxId: 1063]}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrks

SCOPe Domain Coordinates for d3v3yh2:

Click to download the PDB-style file with coordinates for d3v3yh2.
(The format of our PDB-style files is described here.)

Timeline for d3v3yh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3v3yh1