Lineage for d3ulef_ (3ule F:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1685231Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
    alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta
  4. 1685314Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family) (S)
  5. 1685315Family d.198.2.1: Arp2/3 complex subunits [69646] (3 proteins)
  6. 1685350Protein ARPC4 (20 kDa subunit) [69647] (1 species)
  7. 1685351Species Cow (Bos taurus) [TaxId:9913] [69648] (17 PDB entries)
    Uniprot P59998 # 100% sequence identity
  8. 1685355Domain d3ulef_: 3ule F: [201012]
    Other proteins in same PDB: d3ulea1, d3ulea2, d3uleb1, d3ulec_, d3uled1, d3uled2, d3ulee_, d3uleg_
    automated match to d1k8kf_
    complexed with atp, c69, ca

Details for d3ulef_

PDB Entry: 3ule (more details), 2.5 Å

PDB Description: Structure of Bos taurus Arp2/3 complex with bound inhibitor CK-869 and ATP
PDB Compounds: (F:) Actin-related protein 2/3 complex subunit 4

SCOPe Domain Sequences for d3ulef_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ulef_ d.198.2.1 (F:) ARPC4 (20 kDa subunit) {Cow (Bos taurus) [TaxId: 9913]}
tatlrpylsavratlqaalclenfssqvverhnkpevevrsskelllqpvtisrnekekv
liegsinsvrvsiavkqadeiekilchkfmrfmmmraenffilrrkpvegydisflitnf
hteqmykhklvdfvihfmeeidkeisemklsvnararivaeeflknf

SCOPe Domain Coordinates for d3ulef_:

Click to download the PDB-style file with coordinates for d3ulef_.
(The format of our PDB-style files is described here.)

Timeline for d3ulef_: