SCOPe 2.03: Domain d3ukra1: 3ukr A:3-160

Lineage for d3ukra1 (3ukr A:3-160)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein Actin-related protein 3, Arp3 [69528] (1 species)
   part of Arp2/3 complex

7. Species Cow (Bos taurus) [TaxId:9913] [69529] (16 PDB entries)
   Uniprot P61158

8. Domain d3ukra1: 3ukr A:3-160 [200991]
   Other proteins in same PDB: d3ukrb_, d3ukrc_, d3ukrd1, d3ukrd2, d3ukre_, d3ukrf_, d3ukrg_
   automated match to d1k8ka1
   complexed with ckh

Details for d3ukra1

PDB Entry: 3ukr, 2.48 Å

PDB Description: Crystal structure of Bos taurus Arp2/3 complex with bound inhibitor CK-666

PDB Compounds: (A:) Actin-related protein 3

SCOPe Domain Sequences for d3ukra1:

Sequence, based on SEQRES records:

>d3ukra1 c.55.1.1 (A:3-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]}
grlpacvvdcgtgytklgyagntepqfiipsciaikesakvgdqaqrrvmkgvddldffi
gdeaiekptyatkwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpen
reytaeimfesfnvpglyiavqavlalaaswtsrqvge

Sequence, based on observed residues (ATOM records):

>d3ukra1 c.55.1.1 (A:3-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]}
grlpacvvdcgtgytklgyagntepqfiipsciaikesvmkgvddldffigdeaiekpty
atkwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpenreytaeimfe
sfnvpglyiavqavlalaaswtsrqvge

Timeline for d3ukra1:

• d3ukra1 is new in SCOPe 2.03-stable
  
• d3ukra1 appears in SCOPe 2.04
  
• d3ukra1 appears in the current release, SCOPe 2.08