Lineage for d1k8ka1 (1k8k A:3-160)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1372365Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) (S)
    duplication contains two domains of this fold
  5. 1372366Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 1372555Protein Actin-related protein 3, Arp3 [69528] (1 species)
    part of Arp2/3 complex
  7. 1372556Species Cow (Bos taurus) [TaxId:9913] [69529] (16 PDB entries)
    Uniprot P61158
  8. 1372557Domain d1k8ka1: 1k8k A:3-160 [68305]
    Other proteins in same PDB: d1k8kb1, d1k8kc_, d1k8kd1, d1k8kd2, d1k8ke_, d1k8kf_, d1k8kg_

Details for d1k8ka1

PDB Entry: 1k8k (more details), 2 Å

PDB Description: Crystal Structure of Arp2/3 Complex
PDB Compounds: (A:) actin-like protein 3

SCOPe Domain Sequences for d1k8ka1:

Sequence, based on SEQRES records: (download)

>d1k8ka1 c.55.1.1 (A:3-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]}
grlpacvvdcgtgytklgyagntepqfiipsciaikesakvgdqaqrrvmkgvddldffi
gdeaiekptyatkwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpen
reytaeimfesfnvpglyiavqavlalaaswtsrqvge

Sequence, based on observed residues (ATOM records): (download)

>d1k8ka1 c.55.1.1 (A:3-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]}
grlpacvvdcgtgytklgyagntepqfiipsciaikevmkgvddldffigdeaiekptya
tkwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpenreytaeimfes
fnvpglyiavqavlalaaswtsrqvge

SCOPe Domain Coordinates for d1k8ka1:

Click to download the PDB-style file with coordinates for d1k8ka1.
(The format of our PDB-style files is described here.)

Timeline for d1k8ka1: