![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
![]() | Protein Actin-related protein 3, Arp3 [69528] (1 species) part of Arp2/3 complex |
![]() | Species Cow (Bos taurus) [TaxId:9913] [69529] (16 PDB entries) Uniprot P61158 |
![]() | Domain d1k8ka1: 1k8k A:3-160 [68305] Other proteins in same PDB: d1k8kb1, d1k8kc_, d1k8kd1, d1k8kd2, d1k8ke_, d1k8kf_, d1k8kg_ |
PDB Entry: 1k8k (more details), 2 Å
SCOPe Domain Sequences for d1k8ka1:
Sequence, based on SEQRES records: (download)
>d1k8ka1 c.55.1.1 (A:3-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]} grlpacvvdcgtgytklgyagntepqfiipsciaikesakvgdqaqrrvmkgvddldffi gdeaiekptyatkwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpen reytaeimfesfnvpglyiavqavlalaaswtsrqvge
>d1k8ka1 c.55.1.1 (A:3-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]} grlpacvvdcgtgytklgyagntepqfiipsciaikevmkgvddldffigdeaiekptya tkwpirhgivedwdlmerfmeqvifkylraepedhyflltepplntpenreytaeimfes fnvpglyiavqavlalaaswtsrqvge
Timeline for d1k8ka1: