![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.198: Secretion chaperone-like [69634] (5 superfamilies) alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta |
![]() | Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family) ![]() |
![]() | Family d.198.2.1: Arp2/3 complex subunits [69646] (2 proteins) |
![]() | Protein ARPC2 (34 kDa subunit) [69649] (1 species) duplication: tandem repeat of two domains of this fold |
![]() | Species Cow (Bos taurus) [TaxId:9913] [69650] (16 PDB entries) Uniprot O15144 1-282 # 100% sequence identity |
![]() | Domain d1k8kd2: 1k8k D:121-284 [68310] Other proteins in same PDB: d1k8ka1, d1k8ka2, d1k8kb1, d1k8kc_, d1k8ke_, d1k8kf_, d1k8kg_ |
PDB Entry: 1k8k (more details), 2 Å
SCOPe Domain Sequences for d1k8kd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k8kd2 d.198.2.1 (D:121-284) ARPC2 (34 kDa subunit) {Cow (Bos taurus) [TaxId: 9913]} fasvfekyfqfqeegkegenravihyrddetmyveskkdrvtvvfstvfkddddvvigkv fmqefkegrrashtapqvlfshrepplelkdtdaavgdnigyitfvlfprhtnasardnt inlihtfrdylhyhikcskayihtrmraktsdflkvlnrarpda
Timeline for d1k8kd2: