SCOPe 2.03: Domain d3ub5a1: 3ub5 A:6-146

Lineage for d3ub5a1 (3ub5 A:6-146)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein Actin [53073] (7 species)

7. Species Cow (Bos taurus) [TaxId:9913] [53074] (3 PDB entries)

8. Domain d3ub5a1: 3ub5 A:6-146 [200964]
   Other proteins in same PDB: d3ub5p_
   automated match to d2btfa1
   complexed with atp, ca, cl, gol

Details for d3ub5a1

PDB Entry: 3ub5, 2.2 Å

PDB Description: Profilin:actin with a wide open nucleotide cleft

PDB Compounds: (A:) Actin, cytoplasmic 1

SCOPe Domain Sequences for d3ub5a1:

Sequence; same for both SEQRES and ATOM records:

>d3ub5a1 c.55.1.1 (A:6-146) Actin {Cow (Bos taurus) [TaxId: 9913]}
aalvvdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgil
tlkypiehgivtnwddmekiwhhtfynelrvapeehpvllteaplnpkanrekmtqimfe
tfntpamyvaiqavlslyasg

Timeline for d3ub5a1:

• d3ub5a1 is new in SCOPe 2.03-stable
  
• d3ub5a1 appears in SCOPe 2.04
  
• d3ub5a1 appears in the current release, SCOPe 2.08