SCOPe 2.03: Domain d3ub5p_: 3ub5 P:

Lineage for d3ub5p_ (3ub5 P:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.1: Profilin (actin-binding protein) [55770] (2 families)
   alpha-beta(2)-alpha-beta(5)-alpha

5. Family d.110.1.1: Profilin (actin-binding protein) [55771] (2 proteins)
   automatically mapped to Pfam PF00235

6. Protein Profilin (actin-binding protein) [55772] (8 species)

7. Species Cow (Bos taurus) [TaxId:9913] [55773] (5 PDB entries)

8. Domain d3ub5p_: 3ub5 P: [195498]
   Other proteins in same PDB: d3ub5a1, d3ub5a2
   automated match to d1pnea_
   complexed with atp, ca, cl, gol

Details for d3ub5p_

PDB Entry: 3ub5, 2.2 Å

PDB Description: Profilin:actin with a wide open nucleotide cleft

PDB Compounds: (P:) Profilin-1

SCOPe Domain Sequences for d3ub5p_:

Sequence; same for both SEQRES and ATOM records:

>d3ub5p_ d.110.1.1 (P:) Profilin (actin-binding protein) {Cow (Bos taurus) [TaxId: 9913]}
agwnayidnlmadgtcqdaaivgykdspsvwaavpgktfvnitpaevgilvgkdrssffv
ngltlggqkcsvirdsllqdgeftmdlrtkstggaptfnitvtmtaktlvllmgkegvhg
gminkkcyemashlrrsqy

Timeline for d3ub5p_:

• d3ub5p_ first appeared in SCOPe 2.02
  
• d3ub5p_ appears in SCOPe 2.04
  
• d3ub5p_ appears in the current release, SCOPe 2.08