| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily) core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest |
Superfamily c.43.1: CoA-dependent acyltransferases [52777] (5 families) ![]() |
| Family c.43.1.1: CAT-like [52778] (3 proteins) trimeric enzymes with the active sites being located in between subunits |
| Protein Chloramphenicol acetyltransferase, CAT [52779] (2 species) |
| Species Escherichia coli [TaxId:562] [52780] (9 PDB entries) Uniprot P00483 |
| Domain d3u9fj_: 3u9f J: [200954] automated match to d1q23b_ complexed with clm |
PDB Entry: 3u9f (more details), 2.9 Å
SCOPe Domain Sequences for d3u9fj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u9fj_ c.43.1.1 (J:) Chloramphenicol acetyltransferase, CAT {Escherichia coli [TaxId: 562]}
ekkitgyttvdisqwhrkehfeafqsvaqctynqtvqlditaflktvkknkhkfypafih
ilarlmnahpefrmamkdgelviwdsvhpcytvfheqtetfsslwseyhddfrqflhiys
qdvacygenlayfpkgfienmffvsanpwvsftsfdlnvanmdnffapvftmgkyytqgd
kvlmplaiqvhhavcdgfhvgrmlnelqqycdewqg
Timeline for d3u9fj_: