Lineage for d3u41f_ (3u41 F:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2349135Fold a.184: TorD-like [89154] (1 superfamily)
    multihelical; bundle
  4. 2349136Superfamily a.184.1: TorD-like [89155] (1 family) (S)
  5. 2349137Family a.184.1.1: TorD-like [89156] (5 proteins)
    Pfam PF06192
  6. 2349153Protein automated matches [191026] (2 species)
    not a true protein
  7. 2349159Species Escherichia coli K-12 [TaxId:83333] [188829] (3 PDB entries)
  8. 2349171Domain d3u41f_: 3u41 F: [200928]
    automated match to d3u41c_
    complexed with cl, gol, peg, so4, trs

Details for d3u41f_

PDB Entry: 3u41 (more details), 2.5 Å

PDB Description: crystal structure of escherichia coli dmsd in space group p212121
PDB Compounds: (F:) Twin-arginine leader-binding protein dmsD

SCOPe Domain Sequences for d3u41f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u41f_ a.184.1.1 (F:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
mthfsqqdnfsvaarvlgalfyyapesaeaaplvavltsdgwetqwplpeaslaplvtaf
qtqceethaqawqrlfvgpwalpsppwgsvwldresvlfgdstlalrqwmrekgiqfemk
qnepedhfgslllmaawlaengrqteceellawhlfpwstrfldvfiekaehpfyralge
larltlaqwqsqllipvavkplfr

SCOPe Domain Coordinates for d3u41f_:

Click to download the PDB-style file with coordinates for d3u41f_.
(The format of our PDB-style files is described here.)

Timeline for d3u41f_: