Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.9: IL8-like [54116] (2 superfamilies) beta(3)-alpha |
Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) form dimers with different dimerisation modes |
Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins) |
Protein automated matches [190403] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187277] (10 PDB entries) |
Domain d3tn1a_: 3tn1 A: [200849] automated match to d3tn1d_ complexed with zn; mutant |
PDB Entry: 3tn1 (more details), 2.6 Å
SCOPe Domain Sequences for d3tn1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tn1a_ d.9.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} alaadtataccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvqk yvsdlels
Timeline for d3tn1a_:
View in 3D Domains from other chains: (mouse over for more information) d3tn1b_, d3tn1c_, d3tn1d_, d3tn1e_ |