Lineage for d3tn1d_ (3tn1 D:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1400629Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 1400630Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 1400631Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 proteins)
  6. 1400890Protein automated matches [190403] (2 species)
    not a true protein
  7. 1400891Species Human (Homo sapiens) [TaxId:9606] [187277] (10 PDB entries)
  8. 1400916Domain d3tn1d_: 3tn1 D: [193534]
    automated match to d1b53a_
    complexed with zn; mutant

Details for d3tn1d_

PDB Entry: 3tn1 (more details), 2.6 Å

PDB Description: Structure analysis of the Mip1a P8A mutant
PDB Compounds: (D:) C-C motif chemokine 3

SCOPe Domain Sequences for d3tn1d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tn1d_ d.9.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alaadtataccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvqk
yvsdlels

SCOPe Domain Coordinates for d3tn1d_:

Click to download the PDB-style file with coordinates for d3tn1d_.
(The format of our PDB-style files is described here.)

Timeline for d3tn1d_: