SCOPe 2.07: Domain d3ta3c1: 3ta3 C:1-117

Lineage for d3ta3c1 (3ta3 C:1-117)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)

8. Domain d3ta3c1: 3ta3 C:1-117 [200785]
   Other proteins in same PDB: d3ta3a1, d3ta3a2, d3ta3b_, d3ta3c2, d3ta3d1, d3ta3d2
   automated match to d1qrnd1
   complexed with 3tf, nag

Details for d3ta3c1

PDB Entry: 3ta3, 2.7 Å

PDB Description: structure of the mouse cd1d-glc-dag-s2-inkt tcr complex

PDB Compounds: (C:) Valpha14 chimera (mouse variable domain, human constant domain)

SCOPe Domain Sequences for d3ta3c1:

Sequence; same for both SEQRES and ATOM records:

>d3ta3c1 b.1.1.0 (C:1-117) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tqveqspqslvvrqgencvlqcnysvtpdnhlrwfkqdtgkglvsltvlvdqkdktsngr
ysatldkdakhstlhitatllddtatyicvvgdrgsalgrlhfgagtqlivipd

Timeline for d3ta3c1:

• d3ta3c1 first appeared in SCOPe 2.03
  
• d3ta3c1 appears in SCOPe 2.06
  
• d3ta3c1 appears in the current release, SCOPe 2.08