Lineage for d3sx2f_ (3sx2 F:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2454167Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2454168Protein automated matches [190069] (309 species)
    not a true protein
  7. 2456057Species Mycobacterium avium [TaxId:262316] [196266] (1 PDB entry)
  8. 2456063Domain d3sx2f_: 3sx2 F: [200731]
    automated match to d3sx2h_
    complexed with mpd, nad

Details for d3sx2f_

PDB Entry: 3sx2 (more details), 1.5 Å

PDB Description: crystal structure of a putative 3-ketoacyl-(acyl-carrier-protein) reductase from mycobacterium paratuberculosis in complex with nad
PDB Compounds: (F:) Putative 3-ketoacyl-(acyl-carrier-protein) reductase

SCOPe Domain Sequences for d3sx2f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sx2f_ c.2.1.0 (F:) automated matches {Mycobacterium avium [TaxId: 262316]}
rssegpltgkvafitgaargqgrahavrlaadgadiiavdlcdqiasvpyplatpeelaa
tvklvedigsrivarqadvrdreslsaalqagldelgrldivvanagiapmsagddgwhd
vidvnltgvyhtikvaiptlvkqgtggsivlisssaglagvgsadpgsvgyvaakhgvvg
lmrvyanllagqmirvnsihpsgvetpminneftrewlakmaaatdtpgamgnampvevl
apedvanavawlvsdqaryitgvtlpvdagflnk

SCOPe Domain Coordinates for d3sx2f_:

Click to download the PDB-style file with coordinates for d3sx2f_.
(The format of our PDB-style files is described here.)

Timeline for d3sx2f_: