SCOPe 2.04: Domain d3svna_: 3svn A:

Lineage for d3svna_ (3svn A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (14 species)
   not a true protein

7. Species Artificial gene [TaxId:32630] [189424] (7 PDB entries)

8. Domain d3svna_: 3svn A: [200703]
   automated match to d3svnd_
   mutant

Details for d3svna_

PDB Entry: 3svn, 1.9 Å

PDB Description: Crystal structure of mKate S158A mutant at pH 7.5

PDB Compounds: (A:) mKate

SCOPe Domain Sequences for d3svna_:

Sequence; same for both SEQRES and ATOM records:

>d3svna_ d.22.1.1 (A:) automated matches {Artificial gene [TaxId: 32630]}
aaasmsalitenmhmklymegtvnnhhfkctsegegkpyegtqtmrikvveggplpfafd
ilatsfmygsktfinhtqgipdffkqsfpegftwervttyedggvltatqdtslqdgcli
ynvkirgvnfpsngpvmqkktlgweastemlypadgglegradmalklvggghlicnlkt
tyrskkpaknlkmpgvyyvdrrlerikeadketyveqhevavarycdlpsklahk

Timeline for d3svna_:

• d3svna_ first appeared in SCOPe 2.03
  
• d3svna_ appears in SCOPe 2.05
  
• d3svna_ appears in the current release, SCOPe 2.08