Lineage for d3spsd_ (3sps D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2943540Family d.38.1.1: 4HBT-like [54638] (19 proteins)
    Pfam PF03061
  6. 2943550Protein Acyl-CoA hydrolase BH0798 [117883] (1 species)
  7. 2943551Species Bacillus halodurans [TaxId:86665] [117884] (2 PDB entries)
    Uniprot Q9KEQ1
  8. 2943558Domain d3spsd_: 3sps D: [200691]
    automated match to d1vpma_

Details for d3spsd_

PDB Entry: 3sps (more details), 2.9 Å

PDB Description: Crystal Structure of Apo-Hexameric Acyl-CoA Thioesterase
PDB Compounds: (D:) acyl-CoA hydrolase

SCOPe Domain Sequences for d3spsd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3spsd_ d.38.1.1 (D:) Acyl-CoA hydrolase BH0798 {Bacillus halodurans [TaxId: 86665]}
iqsypversrtiqtrlvlppdtnhlgtifggkvlayideiaaltamkhansavvtasids
vdfkssatvgdalelegfvthtgrtsmevyvrvhsnnlltgertlttesfltmvavdesg
kpkpvpqvepqteeekrlyetaparkenrkkraal

SCOPe Domain Coordinates for d3spsd_:

Click to download the PDB-style file with coordinates for d3spsd_.
(The format of our PDB-style files is described here.)

Timeline for d3spsd_: