PDB entry 3sps

View 3sps on RCSB PDB site
Description: Crystal Structure of Apo-Hexameric Acyl-CoA Thioesterase
Class: hydrolase
Keywords: Hotdog, Thioesterase, HYDROLASE
Deposited on 2011-07-03, released 2011-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-17, with a file datestamp of 2011-08-12.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.234
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acyl-CoA hydrolase
    Species: BACILLUS HALODURANS [TaxId:272558]
    Gene: BH0798
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3spsa_
  • Chain 'B':
    Compound: acyl-CoA hydrolase
    Species: BACILLUS HALODURANS [TaxId:272558]
    Gene: BH0798
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3spsb_
  • Chain 'C':
    Compound: acyl-CoA hydrolase
    Species: BACILLUS HALODURANS [TaxId:272558]
    Gene: BH0798
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3spsc_
  • Chain 'D':
    Compound: acyl-CoA hydrolase
    Species: BACILLUS HALODURANS [TaxId:272558]
    Gene: BH0798
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3spsd_
  • Chain 'E':
    Compound: acyl-CoA hydrolase
    Species: BACILLUS HALODURANS [TaxId:272558]
    Gene: BH0798
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3spse_
  • Chain 'F':
    Compound: acyl-CoA hydrolase
    Species: BACILLUS HALODURANS [TaxId:272558]
    Gene: BH0798
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3spsf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3spsA (A:)
    mgsdkihhhhhhmiqsypversrtiqtrlvlppdtnhlgtifggkvlayideiaaltamk
    hansavvtasidsvdfkssatvgdalelegfvthtgrtsmevyvrvhsnnlltgertltt
    esfltmvavdesgkpkpvpqvepqteeekrlyetaparkenrkkraalr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3spsA (A:)
    iqsypversrtiqtrlvlppdtnhlgtifggkvlayideiaaltamkhansavvtasids
    vdfkssatvgdalelegfvthtgrtsmevyvrvhsnnlltgertlttesfltmvavdesg
    kpkpvpqvepqteeekrlyetaparkenrkkraalr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3spsB (B:)
    mgsdkihhhhhhmiqsypversrtiqtrlvlppdtnhlgtifggkvlayideiaaltamk
    hansavvtasidsvdfkssatvgdalelegfvthtgrtsmevyvrvhsnnlltgertltt
    esfltmvavdesgkpkpvpqvepqteeekrlyetaparkenrkkraalr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3spsB (B:)
    iqsypversrtiqtrlvlppdtnhlgtifggkvlayideiaaltamkhansavvtasids
    vdfkssatvgdalelegfvthtgrtsmevyvrvhsnnlltgertlttesfltmvavdesg
    kpkpvpqvepqteeekrlyetaparkenrkkraalr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3spsC (C:)
    mgsdkihhhhhhmiqsypversrtiqtrlvlppdtnhlgtifggkvlayideiaaltamk
    hansavvtasidsvdfkssatvgdalelegfvthtgrtsmevyvrvhsnnlltgertltt
    esfltmvavdesgkpkpvpqvepqteeekrlyetaparkenrkkraalr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3spsC (C:)
    iqsypversrtiqtrlvlppdtnhlgtifggkvlayideiaaltamkhansavvtasids
    vdfkssatvgdalelegfvthtgrtsmevyvrvhsnnlltgertlttesfltmvavdesg
    kpkpvpqvepqteeekrlyetaparkenrkkraal
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3spsD (D:)
    mgsdkihhhhhhmiqsypversrtiqtrlvlppdtnhlgtifggkvlayideiaaltamk
    hansavvtasidsvdfkssatvgdalelegfvthtgrtsmevyvrvhsnnlltgertltt
    esfltmvavdesgkpkpvpqvepqteeekrlyetaparkenrkkraalr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3spsD (D:)
    iqsypversrtiqtrlvlppdtnhlgtifggkvlayideiaaltamkhansavvtasids
    vdfkssatvgdalelegfvthtgrtsmevyvrvhsnnlltgertlttesfltmvavdesg
    kpkpvpqvepqteeekrlyetaparkenrkkraal
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3spsE (E:)
    mgsdkihhhhhhmiqsypversrtiqtrlvlppdtnhlgtifggkvlayideiaaltamk
    hansavvtasidsvdfkssatvgdalelegfvthtgrtsmevyvrvhsnnlltgertltt
    esfltmvavdesgkpkpvpqvepqteeekrlyetaparkenrkkraalr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3spsE (E:)
    iqsypversrtiqtrlvlppdtnhlgtifggkvlayideiaaltamkhansavvtasids
    vdfkssatvgdalelegfvthtgrtsmevyvrvhsnnlltgertlttesfltmvavdesg
    kpkpvpqvepqteeekrlyetaparkenrkkraalr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3spsF (F:)
    mgsdkihhhhhhmiqsypversrtiqtrlvlppdtnhlgtifggkvlayideiaaltamk
    hansavvtasidsvdfkssatvgdalelegfvthtgrtsmevyvrvhsnnlltgertltt
    esfltmvavdesgkpkpvpqvepqteeekrlyetaparkenrkkraalr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3spsF (F:)
    iqsypversrtiqtrlvlppdtnhlgtifggkvlayideiaaltamkhansavvtasids
    vdfkssatvgdalelegfvthtgrtsmevyvrvhsnnlltgertlttesfltmvavdesg
    kpkpvpqvepqteeekrlyetaparkenrkkraal