Lineage for d3soza_ (3soz A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2858750Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2859238Family c.23.16.9: STM3548-like [159492] (2 proteins)
    Pfam PF07090; DUF1355
  6. 2859247Protein automated matches [193670] (1 species)
    not a true protein
  7. 2859248Species Salmonella enterica [TaxId:99287] [193671] (1 PDB entry)
  8. 2859249Domain d3soza_: 3soz A: [200685]
    automated match to d3sozc_
    complexed with gol

Details for d3soza_

PDB Entry: 3soz (more details), 2.6 Å

PDB Description: Cytoplasmic Protein STM1381 from Salmonella typhimurium LT2
PDB Compounds: (A:) Cytoplasmic Protein STM1381

SCOPe Domain Sequences for d3soza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3soza_ c.23.16.9 (A:) automated matches {Salmonella enterica [TaxId: 99287]}
mkilfigeswhihmihskgfdsftsskyeegadyllsclrqgnidvdympahivqtrfpq
taealacydaivisdigsntfllqnrtfynmdiipdalqliadyvaegggllmiggylsf
tgieakanykntvlaevlpvdmldvddrvelpqgckavntavehvitqpfsewppllgyn
kliakensqvlaeingdpllvmgtyhkgkvccfasdcsphwgspqflqwehyatfwcnvl
htikk

SCOPe Domain Coordinates for d3soza_:

Click to download the PDB-style file with coordinates for d3soza_.
(The format of our PDB-style files is described here.)

Timeline for d3soza_: