PDB entry 3soz

View 3soz on RCSB PDB site
Description: Cytoplasmic Protein STM1381 from Salmonella typhimurium LT2
Class: Structural Genomics, Unknown Function
Keywords: Structural Genomics, PSI-Biology, Midwest Center for Structural Genomics, MCSG, Unknown Function, Structure and Function of Pathogen Secreted Proteins, Program for the Characterization of Secreted Effector Proteins, PCSEP
Deposited on 2011-06-30, released 2011-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-08-03, with a file datestamp of 2011-07-29.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.196
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytoplasmic Protein STM1381
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:99287]
    Gene: ORF 245, orf245, STM1381
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3soza_
  • Chain 'B':
    Compound: Cytoplasmic Protein STM1381
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:99287]
    Gene: ORF 245, orf245, STM1381
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3sozb_
  • Chain 'C':
    Compound: Cytoplasmic Protein STM1381
    Species: Salmonella enterica subsp. enterica serovar Typhimurium [TaxId:99287]
    Gene: ORF 245, orf245, STM1381
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3sozc_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3sozA (A:)
    snamkilfigeswhihmihskgfdsftsskyeegadyllsclrqgnidvdympahivqtr
    fpqtaealacydaivisdigsntfllqnrtfynmdiipdalqliadyvaegggllmiggy
    lsftgieakanykntvlaevlpvdmldvddrvelpqgckavntavehvitqpfsewppll
    gynkliakensqvlaeingdpllvmgtyhkgkvccfasdcsphwgspqflqwehyatfwc
    nvlhtikk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sozA (A:)
    mkilfigeswhihmihskgfdsftsskyeegadyllsclrqgnidvdympahivqtrfpq
    taealacydaivisdigsntfllqnrtfynmdiipdalqliadyvaegggllmiggylsf
    tgieakanykntvlaevlpvdmldvddrvelpqgckavntavehvitqpfsewppllgyn
    kliakensqvlaeingdpllvmgtyhkgkvccfasdcsphwgspqflqwehyatfwcnvl
    htikk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3sozB (B:)
    snamkilfigeswhihmihskgfdsftsskyeegadyllsclrqgnidvdympahivqtr
    fpqtaealacydaivisdigsntfllqnrtfynmdiipdalqliadyvaegggllmiggy
    lsftgieakanykntvlaevlpvdmldvddrvelpqgckavntavehvitqpfsewppll
    gynkliakensqvlaeingdpllvmgtyhkgkvccfasdcsphwgspqflqwehyatfwc
    nvlhtikk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sozB (B:)
    mkilfigeswhihmihskgfdsftsskyeegadyllsclrqgnidvdympahivqtrfpq
    taealacydaivisdigsntfllqnrtfynmdiipdalqliadyvaegggllmiggylsf
    tgieakanykntvlaevlpvdmldvddrvelpqgckavntavehvitqpfsewppllgyn
    kliakensqvlaeingdpllvmgtyhkgkvccfasdcsphwgspqflqwehyatfwcnvl
    htikk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3sozC (C:)
    snamkilfigeswhihmihskgfdsftsskyeegadyllsclrqgnidvdympahivqtr
    fpqtaealacydaivisdigsntfllqnrtfynmdiipdalqliadyvaegggllmiggy
    lsftgieakanykntvlaevlpvdmldvddrvelpqgckavntavehvitqpfsewppll
    gynkliakensqvlaeingdpllvmgtyhkgkvccfasdcsphwgspqflqwehyatfwc
    nvlhtikk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3sozC (C:)
    mkilfigeswhihmihskgfdsftsskyeegadyllsclrqgnidvdympahivqtrfpq
    taealacydaivisdigsntfllqnrtfynmdiipdalqliadyvaegggllmiggylsf
    tgieakanykntvlaevlpvdmldvddrvelpqgckavntavehvitqpfsewppllgyn
    kliakensqvlaeingdpllvmgtyhkgkvccfasdcsphwgspqflqwehyatfwcnvl
    htikk