Lineage for d3sm4b_ (3sm4 B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1604195Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 1604196Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families) (S)
  5. 1604378Family c.52.1.13: lambda exonuclease [53017] (1 protein)
  6. 1604379Protein lambda exonuclease [53018] (1 species)
  7. 1604380Species Bacteriophage lambda [TaxId:10710] [53019] (3 PDB entries)
  8. 1604382Domain d3sm4b_: 3sm4 B: [200680]
    automated match to d3sm4c_
    protein/DNA complex; complexed with cl, mg, po4; mutant

Details for d3sm4b_

PDB Entry: 3sm4 (more details), 1.88 Å

PDB Description: crystal structure of the k131a mutant of lambda exonuclease in complex with a 5'-phosphorylated 14-mer/12-mer duplex and magnesium
PDB Compounds: (B:) Exonuclease

SCOPe Domain Sequences for d3sm4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sm4b_ c.52.1.13 (B:) lambda exonuclease {Bacteriophage lambda [TaxId: 10710]}
shmtpdiilqrtgidvraveqgddawhklrlgvitasevhnviakprsgkkwpdmkmsyf
htllaevctgvapevnakalawgkqyendartlfeftsgvnvtespiiyrdesmrtacsp
dglcsdgnglelacpftsrdfmkfrlggfeaiksaymaqvqysmwvtrknawyfanydpr
mkreglhyvvierdekymasfdeivpefiekmdealaeigfvfgeqwr

SCOPe Domain Coordinates for d3sm4b_:

Click to download the PDB-style file with coordinates for d3sm4b_.
(The format of our PDB-style files is described here.)

Timeline for d3sm4b_: