Lineage for d3slfa_ (3slf A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1631618Fold c.140: TTHA0583/YokD-like [110709] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 78612354; strands 3, 4 and 8 are antiparallel to the rest
  4. 1631619Superfamily c.140.1: TTHA0583/YokD-like [110710] (3 families) (S)
  5. 1631635Family c.140.1.0: automated matches [191555] (1 protein)
    not a true family
  6. 1631636Protein automated matches [190957] (3 species)
    not a true protein
  7. 1631650Species Bacillus anthracis [TaxId:198094] [189077] (3 PDB entries)
  8. 1631653Domain d3slfa_: 3slf A: [200678]
    automated match to d3ijwa_
    complexed with aco, cl, ura

Details for d3slfa_

PDB Entry: 3slf (more details), 2.05 Å

PDB Description: crystal structure of ba2930 in complex with accoa and uracil
PDB Compounds: (A:) Aminoglycoside N3-acetyltransferase

SCOPe Domain Sequences for d3slfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3slfa_ c.140.1.0 (A:) automated matches {Bacillus anthracis [TaxId: 198094]}
amndivastqlpntiktitndlrklglkkgmtvivhsslssigwisggavavvealmevi
teegtiimptqssdlsdpkhwsrppvpeewwqiirdnvpafephitptramgkvvecfrt
ypnvvrsnhplgsfaawgrhaeeitvnqslsmslgeesplrkiydldgyilligvgydsn
tsvhlsevrsgacelikvgapiiengervwkefvdmdydsdkfveigvefeqkgtvtmgk
ignakcrlmkqrdivdfgtewfrkk

SCOPe Domain Coordinates for d3slfa_:

Click to download the PDB-style file with coordinates for d3slfa_.
(The format of our PDB-style files is described here.)

Timeline for d3slfa_: