SCOP 1.71: Domain d1bm3h1: 1bm3 H:1-125

Lineage for d1bm3h1 (1bm3 H:1-125)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (49 PDB entries)

8. Domain d1bm3h1: 1bm3 H:1-125 [20067]
   Other proteins in same PDB: d1bm3h2, d1bm3l1, d1bm3l2
   part of anti-integrin Fab OPG2

Details for d1bm3h1

PDB Entry: 1bm3, 2 Å

PDB Description: immunoglobulin opg2 fab-peptide complex

SCOP Domain Sequences for d1bm3h1:

Sequence, based on SEQRES records:

>d1bm3h1 b.1.1.1 (H:1-125) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2}
evqlvqsggglvnpgrslklscaasgftfssygmswvrqtpekrlewvaaisgggtyihy
pdsvkgrftisrdnaknnlylqmsslrsedtalyyctrhpfyrydggnyyamdhwgqgts
vtvsa

Sequence, based on observed residues (ATOM records):

>d1bm3h1 b.1.1.1 (H:1-125) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2}
evqlvqsggglvnpgrslklscaasgftfssygmswvrqtpekrlewvaaisgggtyihy
pdsvkgrftisrdnaknnlylqmsslrsedtalyyctrhamdhwgqgtsvtvsa

Timeline for d1bm3h1:

• d1bm3h1 first appeared (with stable ids) in SCOP 1.55
  
• d1bm3h1 appears in SCOP 1.69
  
• d1bm3h1 appears in SCOP 1.73
  
• d1bm3h1 appears in the current release, SCOPe 2.08