SCOPe 2.04: Domain d3rtib1: 3rti B:1-135

Lineage for d3rtib1 (3rti B:1-135)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (4 families)

5. Family b.42.2.1: Ricin B-like [50371] (11 proteins)

6. Protein Plant cytotoxin B-chain (lectin) [50372] (5 species)
   duplication: consists of two domains of this fold

7. Species Castor bean (Ricinus communis), Ricin [TaxId:3988] [50373] (3 PDB entries)
   Uniprot P06750 303-564

8. Domain d3rtib1: 3rti B:1-135 [200514]
   Other proteins in same PDB: d3rtia_
   automated match to d2aaib1
   complexed with fmp

Details for d3rtib1

PDB Entry: 3rti, 2.8 Å

PDB Description: crystal structure of ricin bound with formycin monophosphate

PDB Compounds: (B:) ricin

SCOPe Domain Sequences for d3rtib1:

Sequence; same for both SEQRES and ATOM records:

>d3rtib1 b.42.2.1 (B:1-135) Plant cytotoxin B-chain (lectin) {Castor bean (Ricinus communis), Ricin [TaxId: 3988]}
advcmdpepivrivgrnglcvdvrdgrfhngnaiqlwpcksntdanqlwtlkrdntirsn
gkclttygyspgvyvmiydcntaatdatrwqiwdngtiinprsslvlaatsgnsgttltv
qtniyavsqgwlptn

Timeline for d3rtib1:

• d3rtib1 first appeared in SCOPe 2.03
  
• d3rtib1 appears in SCOPe 2.05
  
• d3rtib1 appears in the current release, SCOPe 2.08