Class b: All beta proteins [48724] (178 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.6: MOP-like [50331] (4 families) |
Family b.40.6.3: ABC-transporter additional domain [50338] (4 proteins) probably stems out from the biMOP domain |
Protein Maltose transport protein MalK, C-terminal domain [63406] (2 species) |
Species Escherichia coli [TaxId:562] [101772] (15 PDB entries) |
Domain d3rlfa2: 3rlf A:236-371 [200494] Other proteins in same PDB: d3rlfa1, d3rlfa3, d3rlfb1, d3rlfb3, d3rlfe1, d3rlfe2, d3rlff1, d3rlff2, d3rlfg_ automated match to d1q12a1 complexed with anp, mal, mg, pgv, umq |
PDB Entry: 3rlf (more details), 2.2 Å
SCOPe Domain Sequences for d3rlfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rlfa2 b.40.6.3 (A:236-371) Maltose transport protein MalK, C-terminal domain {Escherichia coli [TaxId: 562]} spkmnflpvkvtataidqvqvelpmpnrqqvwlpvesrdvqvganmslgirpehllpsdi advilegevqvveqlgnetqihiqipsirqnlvyrqndvvlveegatfaiglpperchlf redgtacrrlhkepgv
Timeline for d3rlfa2: