Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
Protein automated matches [190115] (94 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [193173] (1 PDB entry) |
Domain d3r8ra_: 3r8r A: [200447] automated match to d3r8rp_ complexed with gol, so4 |
PDB Entry: 3r8r (more details), 1.9 Å
SCOPe Domain Sequences for d3r8ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r8ra_ c.1.10.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]} mlffvdtanideireanelgilagvttnpslvakeanvsfhdrlreitdvvkgsvsaevi slkaeemieegkelakiapnitvkipmtsdglkavraltdlgiktnvtlifnanqallaa ragatyvspflgrlddighngldlisevkqifdihgldtqiiaasirhpqhvteaalrga higtmplkvihaltkhpltdkgieqfladwnk
Timeline for d3r8ra_: