Lineage for d3r8rf_ (3r8r F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835965Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2835966Protein automated matches [190115] (94 species)
    not a true protein
  7. 2836114Species Bacillus subtilis [TaxId:1423] [193173] (1 PDB entry)
  8. 2836120Domain d3r8rf_: 3r8r F: [200452]
    automated match to d3r8rp_
    complexed with gol, so4

Details for d3r8rf_

PDB Entry: 3r8r (more details), 1.9 Å

PDB Description: transaldolase from bacillus subtilis
PDB Compounds: (F:) Transaldolase

SCOPe Domain Sequences for d3r8rf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r8rf_ c.1.10.0 (F:) automated matches {Bacillus subtilis [TaxId: 1423]}
mlffvdtanideireanelgilagvttnpslvakeanvsfhdrlreitdvvkgsvsaevi
slkaeemieegkelakiapnitvkipmtsdglkavraltdlgiktnvtlifnanqallaa
ragatyvspflgrlddighngldlisevkqifdihgldtqiiaasirhpqhvteaalrga
higtmplkvihaltkhpltdkgieqfladwnk

SCOPe Domain Coordinates for d3r8rf_:

Click to download the PDB-style file with coordinates for d3r8rf_.
(The format of our PDB-style files is described here.)

Timeline for d3r8rf_: