![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
![]() | Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) ![]() many members have left-handed crossover connection between strand 8 and additional strand 9 |
![]() | Family c.69.1.18: Bacterial lipase [53570] (4 proteins) lack the first two strands of the common fold |
![]() | Protein automated matches [190277] (12 species) not a true protein |
![]() | Species Bacillus subtilis [TaxId:224308] [196055] (1 PDB entry) |
![]() | Domain d3qzua_: 3qzu A: [200427] automated match to d3qzub_ complexed with cl, gol, so4; mutant |
PDB Entry: 3qzu (more details), 1.85 Å
SCOPe Domain Sequences for d3qzua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qzua_ c.69.1.18 (A:) automated matches {Bacillus subtilis [TaxId: 224308]} ehnpvvmvhgiggasfnfagiksylvsqgwsqndlyavdfwdktgtnynngpvlsrfvqk vldetgakkvdivahsmggantlyyiknldggnkvanvvtlgganrlttgdalpgtdpnq kilytsiyssaddivmnclsrldgarnvqihgvghmgllyssqvnslikeglngggqntn
Timeline for d3qzua_: