Lineage for d3qvqb_ (3qvq B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2448305Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) (S)
  5. 2448392Family c.1.18.0: automated matches [191539] (1 protein)
    not a true family
  6. 2448393Protein automated matches [190919] (11 species)
    not a true protein
  7. 2448407Species Oleispira antarctica [TaxId:188908] [196362] (1 PDB entry)
  8. 2448409Domain d3qvqb_: 3qvq B: [200414]
    automated match to d3qvqd_
    complexed with cl, edo, g3p, mg, na, ni, peg

Details for d3qvqb_

PDB Entry: 3qvq (more details), 1.6 Å

PDB Description: the structure of an oleispira antarctica phosphodiesterase olei02445 in complex with the product sn-glycerol-3-phosphate
PDB Compounds: (B:) Phosphodiesterase Olei02445

SCOPe Domain Sequences for d3qvqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qvqb_ c.1.18.0 (B:) automated matches {Oleispira antarctica [TaxId: 188908]}
gmqsaysflpqviahrgssgqapentlaslhlagqqgikwveidvmlsgdgipvifhddy
lsrttdgdgliyktplaelkqldagswkgqeyqqetiptlleaievisqygmglnlelkp
cegleeetiaasvevlkqhwpqdlpllfssfnyfalvsakalwpeiargynvsaipsawq
erlehldcaglhihqsffdvqqvsdikaagykvlaftindeslalklynqgldavfsdyp
qkiqsaidsh

SCOPe Domain Coordinates for d3qvqb_:

Click to download the PDB-style file with coordinates for d3qvqb_.
(The format of our PDB-style files is described here.)

Timeline for d3qvqb_: