SCOPe 2.04: Domain d3qvqb_: 3qvq B:

Lineage for d3qvqb_ (3qvq B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families)

5. Family c.1.18.0: automated matches [191539] (1 protein)
   not a true family

6. Protein automated matches [190919] (9 species)
   not a true protein

7. Species Oleispira antarctica [TaxId:188908] [196362] (1 PDB entry)

8. Domain d3qvqb_: 3qvq B: [200414]
   automated match to d3qvqd_
   complexed with cl, edo, g3p, mg, na, ni, peg

Details for d3qvqb_

PDB Entry: 3qvq, 1.6 Å

PDB Description: the structure of an oleispira antarctica phosphodiesterase olei02445 in complex with the product sn-glycerol-3-phosphate

PDB Compounds: (B:) Phosphodiesterase Olei02445

SCOPe Domain Sequences for d3qvqb_:

Sequence; same for both SEQRES and ATOM records:

>d3qvqb_ c.1.18.0 (B:) automated matches {Oleispira antarctica [TaxId: 188908]}
gmqsaysflpqviahrgssgqapentlaslhlagqqgikwveidvmlsgdgipvifhddy
lsrttdgdgliyktplaelkqldagswkgqeyqqetiptlleaievisqygmglnlelkp
cegleeetiaasvevlkqhwpqdlpllfssfnyfalvsakalwpeiargynvsaipsawq
erlehldcaglhihqsffdvqqvsdikaagykvlaftindeslalklynqgldavfsdyp
qkiqsaidsh

Timeline for d3qvqb_:

• d3qvqb_ first appeared in SCOPe 2.03
  
• d3qvqb_ appears in SCOPe 2.05
  
• d3qvqb_ appears in the current release, SCOPe 2.08