Lineage for d1lmkg2 (1lmk G:201-312)
- Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) 
Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered speciesSpecies Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (132 PDB entries)
Uniprot P01631 #KV2G_MOUSE Ig kappa chain V-II region 26-10; 79% sequence identity ! Uniprot P06310 # KV2F_HUMAN IG KAPPA CHAIN V-II REGION RPMI 6410 PRECURSOR ! Uniprot P03976 # KV2E_MOUSE (P03976) Ig kappa chain V-II region 17S29.1 ! Uniprot P01642 21-115 # ! KV2G_MOUSE IG KAPPA CHAIN V-II REGION 26-10
Domain d1lmkg2: 1lmk G:201-312 [20041]
Other proteins in same PDB: d1lmka1, d1lmkc1, d1lmke1, d1lmkg1
part of scFv diabody L5MK16
Details for d1lmkg2
PDB Entry: 1lmk (more details), 2.6 Å
PDB Description: the structure of a bivalent diabody
PDB Compounds: (G:) anti-phosphatidylinositol specific phospholipase c diabodySCOPe Domain Sequences for d1lmkg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lmkg2 b.1.1.1 (G:201-312) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]}
dieltqsplslpvslgdqasiscrssqslvhsngntslhwylkkpgqspklliykvstrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpftfgsgtklelk
SCOPe Domain Coordinates for d1lmkg2:
Click to download the PDB-style file with coordinates for d1lmkg2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lmkg2:
View in 3D
