SCOPe 2.07: Domain d3qfac1: 3qfa C:2-105

Lineage for d3qfac1 (3qfa C:2-105)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.1: Thioltransferase [52834] (16 proteins)

6. Protein automated matches [190442] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189547] (7 PDB entries)

8. Domain d3qfac1: 3qfa C:2-105 [200327]
   Other proteins in same PDB: d3qfac2, d3qfad2
   automated match to d3qfbd_
   complexed with fad, gol

Details for d3qfac1

PDB Entry: 3qfa, 2.2 Å

PDB Description: Crystal structure of the human thioredoxin reductase-thioredoxin complex

PDB Compounds: (C:) thioredoxin

SCOPe Domain Sequences for d3qfac1:

Sequence; same for both SEQRES and ATOM records:

>d3qfac1 c.47.1.1 (C:2-105) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vkqiesktafqealdaagdklvvvdfsatwcgpskmikpffhslsekysnviflevdvdd
cqdvasecevksmptfqffkkgqkvgefsgankekleatinelv

Timeline for d3qfac1:

• d3qfac1 first appeared in SCOPe 2.03, called d3qfac_
  
• d3qfac1 appears in SCOPe 2.06
  
• d3qfac1 appears in the current release, SCOPe 2.08