Class a: All alpha proteins [46456] (289 folds) |
Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
Protein automated matches [190036] (39 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [196063] (2 PDB entries) |
Domain d3qb9d_: 3qb9 D: [200301] automated match to d3qb9f_ complexed with fe, hem, na |
PDB Entry: 3qb9 (more details), 2.11 Å
SCOPe Domain Sequences for d3qb9d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qb9d_ a.25.1.0 (D:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} mqgdpdvlrllneqltseltainqyflhskmqdnwgftelaahtraesfdemrhaeeitd rillldglpnyqrigslrigqtlreqfeadlaieydvlnrlkpgivmcrekqdttsavll ekivadeeehidyletqlelmdklgeelysaqcvsrppt
Timeline for d3qb9d_: