Lineage for d1fptl1 (1fpt L:1-108)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 52205Species Fab C3, neutralizing type 1 poliovirus, (mouse), kappa L chain [48797] (1 PDB entry)
  8. 52207Domain d1fptl1: 1fpt L:1-108 [20030]
    Other proteins in same PDB: d1fpth2, d1fptl2

Details for d1fptl1

PDB Entry: 1fpt (more details), 3 Å

PDB Description: three-dimensional structure of the complex between the fab fragment of an neutralizing antibody for type 1 poliovirus and its viral epitope

SCOP Domain Sequences for d1fptl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fptl1 b.1.1.1 (L:1-108) Immunoglobulin (variable domains of L and H chains) {Fab C3, neutralizing type 1 poliovirus, (mouse), kappa L chain}
dvvmtqtplslpvslgdqasiscsssqslvhsngktylhwylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtyftlkisrveaedlgvyfcsqsthvpytfgggtkleikr

SCOP Domain Coordinates for d1fptl1:

Click to download the PDB-style file with coordinates for d1fptl1.
(The format of our PDB-style files is described here.)

Timeline for d1fptl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1fptl2