Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (15 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) |
Domain d3q3gc2: 3q3g C:114-220 [200281] Other proteins in same PDB: d3q3ga1, d3q3gb1, d3q3gb2, d3q3gc1, d3q3gd1, d3q3gd2, d3q3ge_, d3q3gf1, d3q3gg_, d3q3gh1, d3q3gh2, d3q3gi_, d3q3gj1, d3q3gk1, d3q3gk2, d3q3gl_ automated match to d1dqdl2 complexed with ca, cl, edo, gol, na, peg |
PDB Entry: 3q3g (more details), 2.7 Å
SCOPe Domain Sequences for d3q3gc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q3gc2 b.1.1.2 (C:114-220) automated matches {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d3q3gc2: