Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
Domain d3q3gc1: 3q3g C:1-113 [200280] Other proteins in same PDB: d3q3ga2, d3q3gb1, d3q3gb2, d3q3gc2, d3q3gd1, d3q3gd2, d3q3ge_, d3q3gf2, d3q3gg_, d3q3gh1, d3q3gh2, d3q3gi_, d3q3gj2, d3q3gk1, d3q3gk2, d3q3gl_ automated match to d1dqdl1 complexed with ca, cl, edo, gol, na, peg |
PDB Entry: 3q3g (more details), 2.7 Å
SCOPe Domain Sequences for d3q3gc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q3gc1 b.1.1.0 (C:1-113) automated matches {Mouse (Mus musculus) [TaxId: 10090]} diemtqspsslgvsvgekvtmsckssqnllyssnqknylawyqqkpgqspklliywastr esgvpdrftgtgsgtdftltissvkaedlavyycqqyysypltfgagtklelk
Timeline for d3q3gc1: