SCOPe 2.07: Domain d1mrch1: 1mrc H:9-115

Lineage for d1mrch1 (1mrc H:9-115)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (184 PDB entries)
   Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor

8. Domain d1mrch1: 1mrc H:9-115 [20023]
   Other proteins in same PDB: d1mrch2, d1mrch3, d1mrcl1, d1mrcl2
   part of Fab Jel 103
   protein/RNA complex; complexed with imd, so4, zn

Details for d1mrch1

PDB Entry: 1mrc, 2.4 Å

PDB Description: preparation, characterization and crystallization of an antibody fab fragment that recognizes rna. crystal structures of native fab and three fab-mononucleotide complexes

PDB Compounds: (H:) igg2b-kappa jel103 fab (heavy chain)

SCOPe Domain Sequences for d1mrch1:

Sequence, based on SEQRES records:

>d1mrch1 b.1.1.1 (H:9-115) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
aelvkpgasvklsckasgytftsywmqwvkqrpgqglewigeidpsdsytnynqkfkgka
tltvdtssstaymqlssltsedsavyycanlrgyfdywgqgttltvssak

Sequence, based on observed residues (ATOM records):

>d1mrch1 b.1.1.1 (H:9-115) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
aelvkpgasvklsckasgytftsywmqwvkqrpgqglewigeisytnynqkfkgkatltv
dstaymqlssltsedsavyycanlrgyfdywgqgttltvssak

Timeline for d1mrch1:

• d1mrch1 first appeared (with stable ids) in SCOP 1.55
  
• d1mrch1 appears in SCOPe 2.06
  
• d1mrch1 appears in the current release, SCOPe 2.08