Lineage for d3pead_ (3pea D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460576Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2460577Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2461873Family c.14.1.0: automated matches [191346] (1 protein)
    not a true family
  6. 2461874Protein automated matches [190246] (70 species)
    not a true protein
  7. 2461893Species Bacillus anthracis [TaxId:261594] [196404] (1 PDB entry)
  8. 2461897Domain d3pead_: 3pea D: [200213]
    Other proteins in same PDB: d3peac2
    automated match to d3peaf_
    complexed with act, flc, pg4

Details for d3pead_

PDB Entry: 3pea (more details), 1.82 Å

PDB Description: crystal structure of enoyl-coa hydratase from bacillus anthracis str. 'ames ancestor'
PDB Compounds: (D:) Enoyl-CoA hydratase/isomerase family protein

SCOPe Domain Sequences for d3pead_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pead_ c.14.1.0 (D:) automated matches {Bacillus anthracis [TaxId: 261594]}
mlkflsvrvedhiavatlnhapanamssqvmhdvtelidqvekddnirvvvihgegrffs
agadikeftsvteakqatelaqlgqvtfervekcskpviaaihgaalggglefamschmr
fatesaklglpeltlglipgfagtqrlpryvgkakacemmltstpitgaealkwglvngv
faeetflddtlkvakqiagkspataravlellqttksshyyegvqreaqifgevftsedg
regvaaflekrkpsfsg

SCOPe Domain Coordinates for d3pead_:

Click to download the PDB-style file with coordinates for d3pead_.
(The format of our PDB-style files is described here.)

Timeline for d3pead_: