| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.306: YefM-like [143119] (1 superfamily) core: beta-alpha(2)-beta(2)-alpha; mixed beta-sheet, order:123, strands 1 and 2 are parallel; forms compact dimer with a single beta-sheet; |
Superfamily d.306.1: YefM-like [143120] (2 families) ![]() |
| Family d.306.1.0: automated matches [191570] (1 protein) not a true family |
| Protein automated matches [190989] (1 species) not a true protein |
| Species Mycobacterium tuberculosis [TaxId:1773] [188691] (3 PDB entries) |
| Domain d3oein_: 3oei N: [200042] Other proteins in same PDB: d3oeic_, d3oeid_, d3oeig_, d3oeih_, d3oeik_, d3oeil_, d3oeio_, d3oeip_ automated match to d3oeia_ complexed with flc |
PDB Entry: 3oei (more details), 2.15 Å
SCOPe Domain Sequences for d3oein_:
Sequence, based on SEQRES records: (download)
>d3oein_ d.306.1.0 (N:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
sisasearqrlfplieqvntdhqpvritsragdavlmsaddydawqetvyllrspenarr
lmeavardkaghsaftksvdelrem
>d3oein_ d.306.1.0 (N:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
sisasearqrlfplieqvntdhqpvritsragdavlmsaddydawqetvyllrspenarr
lmeavardkagaftksvdelrem
Timeline for d3oein_: