Lineage for d3oeij_ (3oei J:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1947748Fold d.306: YefM-like [143119] (1 superfamily)
    core: beta-alpha(2)-beta(2)-alpha; mixed beta-sheet, order:123, strands 1 and 2 are parallel; forms compact dimer with a single beta-sheet;
  4. 1947749Superfamily d.306.1: YefM-like [143120] (2 families) (S)
  5. 1947763Family d.306.1.0: automated matches [191570] (1 protein)
    not a true family
  6. 1947764Protein automated matches [190989] (1 species)
    not a true protein
  7. 1947765Species Mycobacterium tuberculosis [TaxId:1773] [188691] (3 PDB entries)
  8. 1947775Domain d3oeij_: 3oei J: [200040]
    Other proteins in same PDB: d3oeic_, d3oeid_, d3oeig_, d3oeih_, d3oeik_, d3oeil_, d3oeio_, d3oeip_
    automated match to d3oeia_
    complexed with flc

Details for d3oeij_

PDB Entry: 3oei (more details), 2.15 Å

PDB Description: crystal structure of mycobacterium tuberculosis reljk (rv3357-rv3358- relbe3)
PDB Compounds: (J:) RelJ (Antitoxin Rv3357)

SCOPe Domain Sequences for d3oeij_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oeij_ d.306.1.0 (J:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
sisasearqrlfplieqvntdhqpvritsragdavlmsaddydawqetvyllrspenarr
lmeavardkaghsaftksvdelrema

SCOPe Domain Coordinates for d3oeij_:

Click to download the PDB-style file with coordinates for d3oeij_.
(The format of our PDB-style files is described here.)

Timeline for d3oeij_: