Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily) beta-alpha(3)-beta(2) motif |
Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families) possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1) |
Family d.150.1.0: automated matches [191589] (1 protein) not a true family |
Protein automated matches [191061] (6 species) not a true protein |
Species Corynebacterium ammoniagenes [TaxId:1697] [196390] (2 PDB entries) |
Domain d3nfdf_: 3nfd F: [199944] automated match to d3nfdc_ complexed with coa |
PDB Entry: 3nfd (more details), 1.89 Å
SCOPe Domain Sequences for d3nfdf_:
Sequence, based on SEQRES records: (download)
>d3nfdf_ d.150.1.0 (F:) automated matches {Corynebacterium ammoniagenes [TaxId: 1697]} eamtvgvdlvhipgfaeqlsrpgstfeqvfsplerrhaqtrrsaaadatnsslagsrteh lagrwaakeafikawsqaiygkppviepdlvnfaeievlpdrwgrvalqlkgevaaklqe sigdvelalsishdgdyatalcllryqr
>d3nfdf_ d.150.1.0 (F:) automated matches {Corynebacterium ammoniagenes [TaxId: 1697]} eamtvgvdlvhipgfaeqlsrpgstfeqvfsplerrhaqtragsrtehlagrwaakeafi kawsqaiygkppviepdlvnfaeievlpdrwgrvalqlkgevaaklqesigdvelalsis hdgdyatalcllryqr
Timeline for d3nfdf_: