Lineage for d3nfdd_ (3nfd D:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1437357Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily)
    beta-alpha(3)-beta(2) motif
  4. 1437358Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families) (S)
    possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1)
  5. 1437387Family d.150.1.0: automated matches [191589] (1 protein)
    not a true family
  6. 1437388Protein automated matches [191061] (6 species)
    not a true protein
  7. 1437393Species Corynebacterium ammoniagenes [TaxId:1697] [196390] (2 PDB entries)
  8. 1437397Domain d3nfdd_: 3nfd D: [199942]
    automated match to d3nfdc_
    complexed with coa

Details for d3nfdd_

PDB Entry: 3nfd (more details), 1.89 Å

PDB Description: chronobacterium ammoniagenes acps-coa complex
PDB Compounds: (D:) Phosphopantetheine protein transferase, Ppt1p

SCOPe Domain Sequences for d3nfdd_:

Sequence, based on SEQRES records: (download)

>d3nfdd_ d.150.1.0 (D:) automated matches {Corynebacterium ammoniagenes [TaxId: 1697]}
eamtvgvdlvhipgfaeqlsrpgstfeqvfsplerrhaqtrrsaaadatnsslagsrteh
lagrwaakeafikawsqaiygkppviepdlvnfaeievlpdrwgrvalqlkgevaaklqe
sigdvelalsishdgdyatalcllryqr

Sequence, based on observed residues (ATOM records): (download)

>d3nfdd_ d.150.1.0 (D:) automated matches {Corynebacterium ammoniagenes [TaxId: 1697]}
eamtvgvdlvhipgfaeqlsrpgstfeqvfsplerrhaqtrsrtehlagrwaakeafika
wsqaiygkppviepdlvnfaeievlpdrwgrvalqlkgevaaklqesigdvelalsishd
gdyatalcllryqr

SCOPe Domain Coordinates for d3nfdd_:

Click to download the PDB-style file with coordinates for d3nfdd_.
(The format of our PDB-style files is described here.)

Timeline for d3nfdd_: