Lineage for d3nfda_ (3nfd A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594189Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily)
    beta-alpha(3)-beta(2) motif
  4. 2594190Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families) (S)
    possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1)
  5. 2594223Family d.150.1.0: automated matches [191589] (1 protein)
    not a true family
  6. 2594224Protein automated matches [191061] (11 species)
    not a true protein
  7. 2594242Species Corynebacterium ammoniagenes [TaxId:1697] [196390] (2 PDB entries)
  8. 2594243Domain d3nfda_: 3nfd A: [199941]
    automated match to d3nfdc_
    complexed with coa

Details for d3nfda_

PDB Entry: 3nfd (more details), 1.89 Å

PDB Description: chronobacterium ammoniagenes acps-coa complex
PDB Compounds: (A:) Phosphopantetheine protein transferase, Ppt1p

SCOPe Domain Sequences for d3nfda_:

Sequence, based on SEQRES records: (download)

>d3nfda_ d.150.1.0 (A:) automated matches {Corynebacterium ammoniagenes [TaxId: 1697]}
eamtvgvdlvhipgfaeqlsrpgstfeqvfsplerrhaqtrrsaaadatnsslagsrteh
lagrwaakeafikawsqaiygkppviepdlvnfaeievlpdrwgrvalqlkgevaaklqe
sigdvelalsishdgdyatalcllryqr

Sequence, based on observed residues (ATOM records): (download)

>d3nfda_ d.150.1.0 (A:) automated matches {Corynebacterium ammoniagenes [TaxId: 1697]}
eamtvgvdlvhipgfaeqlsrpgstfeqvfsplerrhaqtragsrtehlagrwaakeafi
kawsqaiygkppviepdlvnfaeievlpdrwgrvalqlkgevaaklqesigdvelalsis
hdgdyatalcllryqr

SCOPe Domain Coordinates for d3nfda_:

Click to download the PDB-style file with coordinates for d3nfda_.
(The format of our PDB-style files is described here.)

Timeline for d3nfda_: