SCOPe 2.05: Domain d3nfda_: 3nfd A:

Lineage for d3nfda_ (3nfd A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily)
   beta-alpha(3)-beta(2) motif

4. Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families)
   possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1)

5. Family d.150.1.0: automated matches [191589] (1 protein)
   not a true family

6. Protein automated matches [191061] (9 species)
   not a true protein

7. Species Corynebacterium ammoniagenes [TaxId:1697] [196390] (2 PDB entries)

8. Domain d3nfda_: 3nfd A: [199941]
   automated match to d3nfdc_
   complexed with coa

Details for d3nfda_

PDB Entry: 3nfd, 1.89 Å

PDB Description: chronobacterium ammoniagenes acps-coa complex

PDB Compounds: (A:) Phosphopantetheine protein transferase, Ppt1p

SCOPe Domain Sequences for d3nfda_:

Sequence, based on SEQRES records:

>d3nfda_ d.150.1.0 (A:) automated matches {Corynebacterium ammoniagenes [TaxId: 1697]}
eamtvgvdlvhipgfaeqlsrpgstfeqvfsplerrhaqtrrsaaadatnsslagsrteh
lagrwaakeafikawsqaiygkppviepdlvnfaeievlpdrwgrvalqlkgevaaklqe
sigdvelalsishdgdyatalcllryqr

Sequence, based on observed residues (ATOM records):

>d3nfda_ d.150.1.0 (A:) automated matches {Corynebacterium ammoniagenes [TaxId: 1697]}
eamtvgvdlvhipgfaeqlsrpgstfeqvfsplerrhaqtragsrtehlagrwaakeafi
kawsqaiygkppviepdlvnfaeievlpdrwgrvalqlkgevaaklqesigdvelalsis
hdgdyatalcllryqr

Timeline for d3nfda_:

• d3nfda_ first appeared in SCOPe 2.03
  
• d3nfda_ appears in SCOPe 2.04
  
• d3nfda_ appears in SCOPe 2.06
  
• d3nfda_ appears in the current release, SCOPe 2.08