![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.150: 4'-phosphopantetheinyl transferase [56213] (1 superfamily) beta-alpha(3)-beta(2) motif |
![]() | Superfamily d.150.1: 4'-phosphopantetheinyl transferase [56214] (3 families) ![]() possibly related to the IspF (d.79.5) and YjgF-like superfamilies (d.79.1) |
![]() | Family d.150.1.0: automated matches [191589] (1 protein) not a true family |
![]() | Protein automated matches [191061] (9 species) not a true protein |
![]() | Species Corynebacterium ammoniagenes [TaxId:1697] [196390] (2 PDB entries) |
![]() | Domain d3nfdc_: 3nfd C: [196391] automated match to d3hyka_ complexed with coa |
PDB Entry: 3nfd (more details), 1.89 Å
SCOPe Domain Sequences for d3nfdc_:
Sequence, based on SEQRES records: (download)
>d3nfdc_ d.150.1.0 (C:) automated matches {Corynebacterium ammoniagenes [TaxId: 1697]} eamtvgvdlvhipgfaeqlsrpgstfeqvfsplerrhaqtrrsaaadatnsslagsrteh lagrwaakeafikawsqaiygkppviepdlvnfaeievlpdrwgrvalqlkgevaaklqe sigdvelalsishdgdyatalcllryqr
>d3nfdc_ d.150.1.0 (C:) automated matches {Corynebacterium ammoniagenes [TaxId: 1697]} eamtvgvdlvhipgfaeqlsrpgstfeqvfsplerrhaqtrragsrtehlagrwaakeaf ikawsqaiygkppviepdlvnfaeievlpdrwgrvalqlkgevaaklqesigdvelalsi shdgdyatalcllryqr
Timeline for d3nfdc_: