| Class b: All beta proteins [48724] (180 folds) |
| Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) ![]() |
| Family b.82.3.2: cAMP-binding domain [51210] (13 proteins) Pfam PF00027 |
| Protein Catabolite gene activator protein, N-terminal domain [51211] (1 species) |
| Species Escherichia coli [TaxId:562] [51212] (32 PDB entries) |
| Domain d3n4ma1: 3n4m A:7-137 [199931] Other proteins in same PDB: d3n4ma2, d3n4mb_, d3n4mc_ automated match to d1i5zb2 protein/DNA complex; protein/RNA complex; complexed with cmp, peg |
PDB Entry: 3n4m (more details), 2.99 Å
SCOPe Domain Sequences for d3n4ma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3n4ma1 b.82.3.2 (A:7-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]}
tdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnq
gdfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqv
tsekvgnlafl
Timeline for d3n4ma1: