PDB entry 3n4m

View 3n4m on RCSB PDB site
Description: E. coli RNA polymerase alpha subunit C-terminal domain in complex with CAP and DNA
Class: gene regulation/DNA
Keywords: protein-protein interactions, protein-DNA interactions, GENE REGULATION-DNA complex
Deposited on 2010-05-21, released 2011-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-05-25, with a file datestamp of 2011-05-20.
Experiment type: XRAY
Resolution: 2.99 Å
R-factor: 0.199
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Catabolite gene activator
    Species: Escherichia coli [TaxId:83333]
    Gene: b3357, cap, crp, csm, JW5702
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n4ma1, d3n4ma2
  • Chain 'B':
    Compound: DNA-directed RNA polymerase subunit alpha
    Species: Escherichia coli [TaxId:83333]
    Gene: b3295, JW3257, pez, phs, rpoA, sez
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n4mb_
  • Chain 'C':
    Compound: DNA-directed RNA polymerase subunit alpha
    Species: Escherichia coli [TaxId:83333]
    Gene: b3295, JW3257, pez, phs, rpoA, sez
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3n4mc_
  • Chain 'D':
    Compound: DNA (5'-d(*cp*tp*tp*tp*tp*tp*tp*cp*cp*tp*ap*ap*ap*ap*tp*gp*tp*gp*ap*t)-3')
  • Chain 'E':
    Compound: DNA (5'-d(*cp*tp*ap*gp*ap*tp*cp*ap*cp*ap*tp*tp*tp*tp*ap*gp*gp*ap*ap*ap*ap*ap*ap*g)-3')
  • Heterogens: CMP, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n4mA (A:)
    vlgkpqtdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemi
    lsylnqgdfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqm
    arrlqvtsekvgnlafldvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsr
    etvgrilkmledqnlisahgktivvygtr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n4mA (A:)
    tdptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnq
    gdfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqv
    tsekvgnlafldvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsretvgri
    lkmledqnlisahgktivvygtr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3n4mB (B:)
    kpefdpillrpvddleltvrsanclkaeaihyigdlvqrtevellktpnlgkkslteikd
    vlasrglslgmrlenwppasiade
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n4mB (B:)
    fdpillrpvddleltvrsanclkaeaihyigdlvqrtevellktpnlgkkslteikdvla
    srglslgmrlenwp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3n4mC (C:)
    kpefdpillrpvddleltvrsanclkaeaihyigdlvqrtevellktpnlgkkslteikd
    vlasrglslgmrlenwppasiade
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n4mC (C:)
    dpillrpvddleltvrsanclkaeaihyigdlvqrtevellktpnlgkkslteikdvlas
    rglslgmrlenwp
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.