![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
![]() | Family c.108.1.0: automated matches [191369] (1 protein) not a true family |
![]() | Protein automated matches [190447] (43 species) not a true protein |
![]() | Species Vibrio cholerae [TaxId:666] [193720] (1 PDB entry) |
![]() | Domain d3n07a_: 3n07 A: [199916] automated match to d3n07d_ complexed with mg |
PDB Entry: 3n07 (more details), 1.76 Å
SCOPe Domain Sequences for d3n07a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3n07a_ c.108.1.0 (A:) automated matches {Vibrio cholerae [TaxId: 666]} sstvstlygevepslleiakqikllicdvdgvfsdgliymgnqgeelktfhtrdgygvka lmnagieiaiitgrrsqivenrmkalgisliyqgqddkvqayydicqklaiapeqtgyig ddlidwpvmekvalrvcvadghpllaqranyvthikgghgavrevcdlilqarneldvh
Timeline for d3n07a_: