PDB entry 3n07

View 3n07 on RCSB PDB site
Description: Structure of putative 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase from Vibrio cholerae
Class: hydrolase
Keywords: structural genomics, phosphatase, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, HYDROLASE
Deposited on 2010-05-13, released 2010-08-04
The last revision prior to the SCOPe 2.03 freeze date was dated 2010-08-04, with a file datestamp of 2010-07-30.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.172
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase
    Species: Vibrio cholerae [TaxId:666]
    Gene: VCD_001835, VC_2524
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3n07a_
  • Chain 'B':
    Compound: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase
    Species: Vibrio cholerae [TaxId:666]
    Gene: VCD_001835, VC_2524
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3n07b_
  • Chain 'C':
    Compound: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase
    Species: Vibrio cholerae [TaxId:666]
    Gene: VCD_001835, VC_2524
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3n07c_
  • Chain 'D':
    Compound: 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase
    Species: Vibrio cholerae [TaxId:666]
    Gene: VCD_001835, VC_2524
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3n07d_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3n07A (A:)
    mslsstvstlygevepslleiakqikllicdvdgvfsdgliymgnqgeelktfhtrdgyg
    vkalmnagieiaiitgrrsqivenrmkalgisliyqgqddkvqayydicqklaiapeqtg
    yigddlidwpvmekvalrvcvadghpllaqranyvthikgghgavrevcdlilqarneld
    vhkglsleghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n07A (A:)
    sstvstlygevepslleiakqikllicdvdgvfsdgliymgnqgeelktfhtrdgygvka
    lmnagieiaiitgrrsqivenrmkalgisliyqgqddkvqayydicqklaiapeqtgyig
    ddlidwpvmekvalrvcvadghpllaqranyvthikgghgavrevcdlilqarneldvh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3n07B (B:)
    mslsstvstlygevepslleiakqikllicdvdgvfsdgliymgnqgeelktfhtrdgyg
    vkalmnagieiaiitgrrsqivenrmkalgisliyqgqddkvqayydicqklaiapeqtg
    yigddlidwpvmekvalrvcvadghpllaqranyvthikgghgavrevcdlilqarneld
    vhkglsleghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n07B (B:)
    sstvstlygevepslleiakqikllicdvdgvfsdgliymgnqgeelktfhtrdgygvka
    lmnagieiaiitgrrsqivenrmkalgisliyqgqddkvqayydicqklaiapeqtgyig
    ddlidwpvmekvalrvcvadghpllaqranyvthikgghgavrevcdlilqarnel
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3n07C (C:)
    mslsstvstlygevepslleiakqikllicdvdgvfsdgliymgnqgeelktfhtrdgyg
    vkalmnagieiaiitgrrsqivenrmkalgisliyqgqddkvqayydicqklaiapeqtg
    yigddlidwpvmekvalrvcvadghpllaqranyvthikgghgavrevcdlilqarneld
    vhkglsleghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n07C (C:)
    sstvstlygevepslleiakqikllicdvdgvfsdgliymgnqgeelktfhtrdgygvka
    lmnagieiaiitgrrsqivenrmkalgisliyqgqddkvqayydicqklaiapeqtgyig
    ddlidwpvmekvalrvcvadghpllaqranyvthikgghgavrevcdlilqarnel
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3n07D (D:)
    mslsstvstlygevepslleiakqikllicdvdgvfsdgliymgnqgeelktfhtrdgyg
    vkalmnagieiaiitgrrsqivenrmkalgisliyqgqddkvqayydicqklaiapeqtg
    yigddlidwpvmekvalrvcvadghpllaqranyvthikgghgavrevcdlilqarneld
    vhkglsleghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3n07D (D:)
    stvstlygevepslleiakqikllicdvdgvfsdgliymgnqgeelktfhtrdgygvkal
    mnagieiaiitgrrsqivenrmkalgisliyqgqddkvqayydicqklaiapeqtgyigd
    dlidwpvmekvalrvcvadghpllaqranyvthikgghgavrevcdlilqarneldv