SCOP 1.71: Domain d1rvfl_: 1rvf L:

Lineage for d1rvfl_ (1rvf L:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88528] (19 PDB entries)

8. Domain d1rvfl_: 1rvf L: [19990]
   Other proteins in same PDB: d1rvf.1, d1rvf1_, d1rvf3_, d1rvfh_
   part of Fv 17-Ia

Details for d1rvfl_

PDB Entry: 1rvf, 4 Å

PDB Description: fab complexed with intact human rhinovirus

SCOP Domain Sequences for d1rvfl_:

Sequence; same for both SEQRES and ATOM records:

>d1rvfl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2}
qivltqspaimsafpgekvtitcsatssvnymhwfqqkpgtspklwiysssnlasgvpar
fsgsgsgtsysltisrmeaedaatyycqqrssypitfgsgtkleikrada

Timeline for d1rvfl_:

• d1rvfl_ first appeared (with stable ids) in SCOP 1.55
  
• d1rvfl_ appears in SCOP 1.69
  
• d1rvfl_ appears in SCOP 1.73
  
• d1rvfl_ appears in the current release, SCOPe 2.08