Lineage for d3mt6l_ (3mt6 L:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460576Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2460577Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2460578Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
    automatically mapped to Pfam PF00574
  6. 2460794Protein automated matches [190149] (15 species)
    not a true protein
  7. 2460868Species Escherichia coli K-12 [TaxId:83333] [196414] (1 PDB entry)
  8. 2460880Domain d3mt6l_: 3mt6 L: [199883]
    automated match to d3mt6g_
    complexed with mpd

Details for d3mt6l_

PDB Entry: 3mt6 (more details), 1.9 Å

PDB Description: structure of clpp from escherichia coli in complex with adep1
PDB Compounds: (L:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d3mt6l_:

Sequence, based on SEQRES records: (download)

>d3mt6l_ c.14.1.1 (L:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
lvpmvieqtsrgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiyl
yinspggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmi
hqplggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeave
yglvdsilth

Sequence, based on observed residues (ATOM records): (download)

>d3mt6l_ c.14.1.1 (L:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
lvpmvieqgersfdiysrllkervifltgqvedhmanlivaqmlfleaenpekdiylyin
spggvitagmsiydtmqfikpdvsticmgqaasmgaflltagakgkrfclpnsrvmihqp
lggyqgqatdieihareilkvkgrmnelmalhtgqsleqierdterdrflsapeaveygl
vdsilth

SCOPe Domain Coordinates for d3mt6l_:

Click to download the PDB-style file with coordinates for d3mt6l_.
(The format of our PDB-style files is described here.)

Timeline for d3mt6l_: