SCOPe 2.06: Domain d3mr7a1: 3mr7 A:1-171

Lineage for d3mr7a1 (3mr7 A:1-171)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.29: Nucleotide cyclase [55073] (3 families)
   common fold is elaborated with additional secondary structures

5. Family d.58.29.0: automated matches [191671] (1 protein)
   not a true family

6. Protein automated matches [191274] (12 species)
   not a true protein

7. Species Ruegeria pomeroyi [TaxId:246200] [196436] (1 PDB entry)

8. Domain d3mr7a1: 3mr7 A:1-171 [199871]
   Other proteins in same PDB: d3mr7a2, d3mr7b2, d3mr7c2
   automated match to d3mr7c_

Details for d3mr7a1

PDB Entry: 3mr7, 2.6 Å

PDB Description: Crystal Structure of Adenylate/Guanylate Cyclase/Hydrolase from Silicibacter pomeroyi

PDB Compounds: (A:) Adenylate/guanylate cyclase/hydrolase, alpha/beta fold family

SCOPe Domain Sequences for d3mr7a1:

Sequence; same for both SEQRES and ATOM records:

>d3mr7a1 d.58.29.0 (A:1-171) automated matches {Ruegeria pomeroyi [TaxId: 246200]}
errlcailaadmagysrlmernetdvlnrqklyrrelidpaiaqaggqivkttgdgmlar
fdtaqaalrcaleiqqamqqreedtprkeriqyriginigdivledgdifgdavnvaarl
eaisepgaicvsdivhqitqdrvsepftdlglqkvknitrpirvwqwvpda

Timeline for d3mr7a1:

• d3mr7a1 first appeared in SCOPe 2.03, called d3mr7a_
  
• d3mr7a1 was called d3mr7a_ in SCOPe 2.05
  
• d3mr7a1 appears in SCOPe 2.07
  
• d3mr7a1 appears in the current release, SCOPe 2.08